PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.10273s0385.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 295aa    MW: 33285.1 Da    PI: 5.2159
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.10273s0385.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox566.7e-1885138356
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rq+ +WFqNrRa++k
  Bostr.10273s0385.1.p  85 KKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWK 138
                           456899***********************************************9 PP

2HD-ZIP_I/II131.72.7e-4284175192
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           ekkrrl+ eqvk+LE++Fe  +kLeperK++lar+Lglqprq+a+WFqnrRAR+ktkqlEkdy+aLkr++dalk+en+ L++++++L++
  Bostr.10273s0385.1.p  84 EKKRRLNMEQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKDYDALKRQFDALKAENDLLQTHNQKLQA 172
                           69**************************************************************************************9 PP

           HD-ZIP_I/II  90 elk 92 
                           e++
  Bostr.10273s0385.1.p 173 EIM 175
                           986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.37E-1973142IPR009057Homeodomain-like
PROSITE profilePS5007117.21680140IPR001356Homeobox domain
SMARTSM003891.8E-1783144IPR001356Homeobox domain
CDDcd000862.31E-1685141No hitNo description
PfamPF000463.0E-1585138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-1987148IPR009057Homeodomain-like
PRINTSPR000311.2E-5111120IPR000047Helix-turn-helix motif
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5120136IPR000047Helix-turn-helix motif
CDDcd146860.00712133174No hitNo description
PfamPF021839.9E-16140179IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009744Biological Processresponse to sucrose
GO:0048826Biological Processcotyledon morphogenesis
GO:0080022Biological Processprimary root development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSCNNGMSFF PSNFMIQTSY EDDHPHQSPS LAPLLPSCSL PQDLHGFASF LGKRSPMEGC  60
CDLEPGNNMN GEEDYSDDGS QMGEKKRRLN MEQVKTLEKN FELGNKLEPE RKMQLARALG  120
LQPRQIAIWF QNRRARWKTK QLEKDYDALK RQFDALKAEN DLLQTHNQKL QAEIMGLKCR  180
EQTESINLNK ETEGSCSNRS DNSSDNLRLD ISTAPPSIES TLTGGQPPPP QTLGRHFFPP  240
SPATATTTTT TMQFFQNSSS GQSMVKEENS ISNMFCAMDD HSGFWPWLDQ QQYN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132140RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00225DAPTransfer from AT1G69780Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2080440.0AF208044.1 Arabidopsis thaliana homeodomain leucine-zipper protein ATHB13 mRNA, complete cds.
GenBankAY0575720.0AY057572.1 Arabidopsis thaliana At1g69780/T6C23_2 mRNA, complete cds.
GenBankAY1336450.0AY133645.1 Arabidopsis thaliana At1g69780/T6C23_2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_177136.10.0homeobox-leucine zipper protein ATHB-13
SwissprotQ8LC030.0ATB13_ARATH; Homeobox-leucine zipper protein ATHB-13
TrEMBLE4MXR40.0E4MXR4_EUTHA; mRNA, clone: RTFL01-34-O11
TrEMBLV4KEK50.0V4KEK5_EUTSA; Uncharacterized protein
STRINGAT1G69780.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26332770
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-172HD-ZIP family protein